SCOPe 2.07: Domain d4fata1: 4fat A:3-263

Lineage for d4fata1 (4fat A:3-263)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d4fata1: 4fat A:3-263 [194984]
   Other proteins in same PDB: d4fata2
   automated match to d3pmva_
   complexed with 496, glu, gol, li, so4

Details for d4fata1

PDB Entry: 4fat, 1.4 Å

PDB Description: ligand-binding domain of glua2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d4fata1:

Sequence; same for both SEQRES and ATOM records:

>d4fata1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlkls
eqgvldklknkwwydkgecga

Timeline for d4fata1:

• d4fata1 first appeared in SCOPe 2.02, called d4fata_
  
• d4fata1 appears in SCOPe 2.06
  
• d4fata1 appears in the current release, SCOPe 2.08