Lineage for d3sssd_ (3sss D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1418485Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 1418486Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 1418520Protein automated matches [191074] (5 species)
    not a true protein
  7. 1418541Species Thermosynechococcus elongatus [TaxId:197221] [194973] (3 PDB entries)
  8. 1418547Domain d3sssd_: 3sss D: [194981]
    automated match to d2a1ba1
    complexed with cl

Details for d3sssd_

PDB Entry: 3sss (more details), 2.05 Å

PDB Description: ccmk1 with residues 103-113 deleted
PDB Compounds: (D:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d3sssd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sssd_ d.58.56.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aiavgmietlgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvaagv
envkrvnggqvlsthiiarphenleyvlpiryteaveqfreleh

SCOPe Domain Coordinates for d3sssd_:

Click to download the PDB-style file with coordinates for d3sssd_.
(The format of our PDB-style files is described here.)

Timeline for d3sssd_: