Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab1a [142241] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries) Uniprot P62820 7-175 |
Domain d4fmcb_: 4fmc B: [194734] automated match to d2fola1 complexed with af3, gdp, mg, pge |
PDB Entry: 4fmc (more details), 2.8 Å
SCOPe Domain Sequences for d4fmcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fmcb_ c.37.1.8 (B:) Rab1a {Human (Homo sapiens) [TaxId: 9606]} peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
Timeline for d4fmcb_: