Lineage for d4gvaa_ (4gva A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588425Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2588511Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (57 PDB entries)
  8. 2588525Domain d4gvaa_: 4gva A: [194703]
    automated match to d1erka_
    complexed with adp, gol

Details for d4gvaa_

PDB Entry: 4gva (more details), 1.83 Å

PDB Description: ADP-bound form of the ERK2 kinase
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d4gvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gvaa_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqrtlrei
killrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyq
ilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrw
yrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedl
nciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpy
leqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy

SCOPe Domain Coordinates for d4gvaa_:

Click to download the PDB-style file with coordinates for d4gvaa_.
(The format of our PDB-style files is described here.)

Timeline for d4gvaa_: