Lineage for d3vk4d_ (3vk4 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503487Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2503498Species Pseudomonas putida [TaxId:303] [75271] (13 PDB entries)
    Uniprot P13254
  8. 2503542Domain d3vk4d_: 3vk4 D: [194667]
    automated match to d1ukja_
    complexed with hcs; mutant

Details for d3vk4d_

PDB Entry: 3vk4 (more details), 2.61 Å

PDB Description: crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-homocysteine
PDB Compounds: (D:) methionine gamma-lyase

SCOPe Domain Sequences for d3vk4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk4d_ c.67.1.3 (D:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d3vk4d_:

Click to download the PDB-style file with coordinates for d3vk4d_.
(The format of our PDB-style files is described here.)

Timeline for d3vk4d_: