Lineage for d4h0db_ (4h0d B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679746Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1679747Protein automated matches [190418] (12 species)
    not a true protein
  7. 1679757Species Klebsiella pneumoniae [TaxId:573] [189718] (28 PDB entries)
  8. 1679771Domain d4h0db_: 4h0d B: [194620]
    automated match to d3srxa_
    complexed with edo, fmt, gol, mn, na, so4, zz7

Details for d4h0db_

PDB Entry: 4h0d (more details), 1.5 Å

PDB Description: New Delhi Metallo-beta-Lactamase-1 Complexed with Mn from Klebsiella pneumoniae
PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4h0db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0db_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
airptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

SCOPe Domain Coordinates for d4h0db_:

Click to download the PDB-style file with coordinates for d4h0db_.
(The format of our PDB-style files is described here.)

Timeline for d4h0db_: