Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Zymomonas mobilis [TaxId:542] [194530] (1 PDB entry) |
Domain d4a3ua_: 4a3u A: [194532] automated match to d3gkaa_ complexed with act, fmn, k, na, nca |
PDB Entry: 4a3u (more details), 1.7 Å
SCOPe Domain Sequences for d4a3ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a3ua_ c.1.4.0 (A:) automated matches {Zymomonas mobilis [TaxId: 542]} pslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgisq eglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvpsnvsgmqpvapsas qapglghtydgkkpydvaralrldeiprllddyekaarhalkagfdgvqihaangylide firdstnhrhdeyggavenrirllkdvterviatigkertavrlspngeiqgtvdshpeq vfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpplvlnqdytfetaq aaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpkgytdypll
Timeline for d4a3ua_: