Lineage for d4a3ua_ (4a3u A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437424Species Zymomonas mobilis [TaxId:542] [194530] (1 PDB entry)
  8. 2437425Domain d4a3ua_: 4a3u A: [194532]
    automated match to d3gkaa_
    complexed with act, fmn, k, na, nca

Details for d4a3ua_

PDB Entry: 4a3u (more details), 1.7 Å

PDB Description: x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr)
PDB Compounds: (A:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d4a3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a3ua_ c.1.4.0 (A:) automated matches {Zymomonas mobilis [TaxId: 542]}
pslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgisq
eglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvpsnvsgmqpvapsas
qapglghtydgkkpydvaralrldeiprllddyekaarhalkagfdgvqihaangylide
firdstnhrhdeyggavenrirllkdvterviatigkertavrlspngeiqgtvdshpeq
vfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpplvlnqdytfetaq
aaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpkgytdypll

SCOPe Domain Coordinates for d4a3ua_:

Click to download the PDB-style file with coordinates for d4a3ua_.
(The format of our PDB-style files is described here.)

Timeline for d4a3ua_: