Lineage for d2qfla_ (2qfl A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621958Family e.7.1.0: automated matches [191440] (1 protein)
    not a true family
  6. 2621959Protein automated matches [190647] (17 species)
    not a true protein
  7. 2621970Species Escherichia coli [TaxId:562] [194326] (6 PDB entries)
  8. 2621971Domain d2qfla_: 2qfl A: [194327]
    automated match to d3luza_
    complexed with act, eee

Details for d2qfla_

PDB Entry: 2qfl (more details), 1.9 Å

PDB Description: structure of suhb: inositol monophosphatase and extragenic suppressor from e. coli
PDB Compounds: (A:) Inositol-1-monophosphatase

SCOPe Domain Sequences for d2qfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfla_ e.7.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mhpmlniavraarkagnliaknyetpdaveasqkgsndfvtnvdkaaeaviidtirksyp
qhtiiteesgelegtdqdvqwvidpldgttnfikrlphfavsiavrikgrtevavvydpm
rnelftatrgqgaqlngyrlrgstardldgtilatgfpfkakqyattyinivgklfneca
dfratgsaaldlayvaagrvdgffeiglrpwdfaagellvreaggivsdftgghnymltg
nivagnprvvkamlanmrdels

SCOPe Domain Coordinates for d2qfla_:

Click to download the PDB-style file with coordinates for d2qfla_.
(The format of our PDB-style files is described here.)

Timeline for d2qfla_: