![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) ![]() |
![]() | Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins) Pfam PF01341 |
![]() | Protein automated matches [191253] (6 species) not a true protein |
![]() | Species Trichoderma reesei [TaxId:51453] [194094] (2 PDB entries) |
![]() | Domain d4ax7c_: 4ax7 C: [194098] automated match to d1cb2a_ complexed with 4mu, man, nag; mutant |
PDB Entry: 4ax7 (more details), 1.7 Å
SCOPe Domain Sequences for d4ax7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ax7c_ c.6.1.1 (C:) automated matches {Trichoderma reesei [TaxId: 51453]} tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq ivveysdirtllviepaslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp sfl
Timeline for d4ax7c_: