SCOPe 2.07: Domain d4h99m_: 4h99 M:

Lineage for d4h99m_ (4h99 M:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
   Uniprot P02953

8. Domain d4h99m_: 4h99 M: [194079]
   Other proteins in same PDB: d4h99h1, d4h99h2, d4h99l_
   automated match to d2j8dm_
   complexed with bcl, bph, fe, spo, u10

Details for d4h99m_

PDB Entry: 4h99, 2.97 Å

PDB Description: bacterial photosynthetic reaction center from rhodobacter sphaeroides with ile m265 replaced with thr

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4h99m_:

Sequence; same for both SEQRES and ATOM records:

>d4h99m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegthrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d4h99m_:

• d4h99m_ first appeared in SCOPe 2.02
  
• d4h99m_ appears in SCOPe 2.06
  
• d4h99m_ appears in the current release, SCOPe 2.08