Lineage for d4ihje_ (4ihj E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505912Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1506079Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 1506080Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 1506081Protein Stathmin 4 [101496] (1 species)
  7. 1506082Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (25 PDB entries)
  8. 1506083Domain d4ihje_: 4ihj E: [194008]
    Other proteins in same PDB: d4ihja1, d4ihja2, d4ihjb1, d4ihjb2, d4ihjc1, d4ihjc2, d4ihjd1, d4ihjd2
    automated match to d3ryce_
    complexed with adp, ca, cl, gdp, gol, gtp, mes, mg

Details for d4ihje_

PDB Entry: 4ihj (more details), 2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-adp complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4ihje_:

Sequence, based on SEQRES records: (download)

>d4ihje_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d4ihje_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d4ihje_:

Click to download the PDB-style file with coordinates for d4ihje_.
(The format of our PDB-style files is described here.)

Timeline for d4ihje_: