Lineage for d4jcpa_ (4jcp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416500Protein automated matches [190077] (21 species)
    not a true protein
  7. 2416581Species Nematode (Brugia malayi) [TaxId:6279] [193907] (1 PDB entry)
  8. 2416582Domain d4jcpa_: 4jcp A: [193908]
    automated match to d1dywa_
    complexed with cl, so4

Details for d4jcpa_

PDB Entry: 4jcp (more details), 1.65 Å

PDB Description: Structure of Cyclophilin B from Brugia malayi
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4jcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcpa_ b.62.1.1 (A:) automated matches {Nematode (Brugia malayi) [TaxId: 6279]}
srpkvffditiggsnagrivmelfadivpktaenfrclctgergmgrsgkklhykgskfh
rvipnfmlqggdftrgngtggesiygekfpdenfqekhtgpgvlsmanagpntngsqffi
ctaktewldgkhvvfgrvvegmnvvkaveskgsqsgrtsadivisdcgql

SCOPe Domain Coordinates for d4jcpa_:

Click to download the PDB-style file with coordinates for d4jcpa_.
(The format of our PDB-style files is described here.)

Timeline for d4jcpa_: