Class b: All beta proteins [48724] (178 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (21 species) not a true protein |
Species Nematode (Brugia malayi) [TaxId:6279] [193907] (1 PDB entry) |
Domain d4jcpa_: 4jcp A: [193908] automated match to d1dywa_ complexed with cl, so4 |
PDB Entry: 4jcp (more details), 1.65 Å
SCOPe Domain Sequences for d4jcpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcpa_ b.62.1.1 (A:) automated matches {Nematode (Brugia malayi) [TaxId: 6279]} srpkvffditiggsnagrivmelfadivpktaenfrclctgergmgrsgkklhykgskfh rvipnfmlqggdftrgngtggesiygekfpdenfqekhtgpgvlsmanagpntngsqffi ctaktewldgkhvvfgrvvegmnvvkaveskgsqsgrtsadivisdcgql
Timeline for d4jcpa_: