![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
![]() | Protein automated matches [193506] (4 species) not a true protein |
![]() | Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries) |
![]() | Domain d4b5dc_: 4b5d C: [193508] automated match to d3sq6e_ complexed with nag, sw4 |
PDB Entry: 4b5d (more details), 2.2 Å
SCOPe Domain Sequences for d4b5dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b5dc_ b.96.1.0 (C:) automated matches {Capitella teleta [TaxId: 283909]} nglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigtf kaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivfs ngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsle ilensaqrqevvypccesayvemkyllalrs
Timeline for d4b5dc_:
![]() Domains from other chains: (mouse over for more information) d4b5da_, d4b5db_, d4b5dd_, d4b5de_ |