![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [193173] (1 PDB entry) |
![]() | Domain d3r8rp_: 3r8r P: [193174] automated match to d1vpxe_ complexed with gol, so4 |
PDB Entry: 3r8r (more details), 1.9 Å
SCOPe Domain Sequences for d3r8rp_:
Sequence, based on SEQRES records: (download)
>d3r8rp_ c.1.10.0 (P:) automated matches {Bacillus subtilis [TaxId: 1423]} mlffvdtanideireanelgilagvttnpslvakeanvsfhdrlreitdvvkgsvsaevi slkaeemieegkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaa ragatyvspflgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrga higtmplkvihaltkhpltdkgieqfladwnk
>d3r8rp_ c.1.10.0 (P:) automated matches {Bacillus subtilis [TaxId: 1423]} mlffvdtanideireanelgilagvttnsfhdrlreitdvvkgsvsaevislkaeemiee gkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaaragatyvspf lgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrgahigtmplkvi haltkhpltdkgieqfladwnk
Timeline for d3r8rp_: