Lineage for d4ha0a_ (4ha0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1342051Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1342052Protein automated matches [190150] (16 species)
    not a true protein
  7. 1342065Species Geobacillus kaustophilus [TaxId:1462] [189526] (9 PDB entries)
  8. 1342075Domain d4ha0a_: 4ha0 A: [193078]
    automated match to d3ojga_
    complexed with fe, oh, zn; mutant

Details for d4ha0a_

PDB Entry: 4ha0 (more details), 1.9 Å

PDB Description: Structure of Geobacillus kaustophilus lactonase, mutant R230D with Zn2+
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d4ha0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ha0a_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafddfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfs

SCOPe Domain Coordinates for d4ha0a_:

Click to download the PDB-style file with coordinates for d4ha0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ha0a_: