Lineage for d4g2da_ (4g2d A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1342051Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1342052Protein automated matches [190150] (16 species)
    not a true protein
  7. 1342115Species Sulfolobus islandicus [TaxId:426118] [193063] (1 PDB entry)
  8. 1342116Domain d4g2da_: 4g2d A: [193064]
    automated match to d2vc7a_
    complexed with co, fe2

Details for d4g2da_

PDB Entry: 4g2d (more details), 2.7 Å

PDB Description: Crystal structure of the hyperthermophilic Sulfolobus islandicus PLL SisLac
PDB Compounds: (A:) aryldialkylphosphatase

SCOPe Domain Sequences for d4g2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g2da_ c.1.9.0 (A:) automated matches {Sulfolobus islandicus [TaxId: 426118]}
mriplvgkepieaedmgftlihehlrvfseavryqwphlynedeelrnavnevkramqfg
vktivdptvmglgrdirfmekvvkttginlvagtgiyiyvdlpfyflnrsideiadlfih
dikegiqatsnkagfvkiaadepgitkdvekviraaaithkeakvpiithsnahnntgle
eqrilmeegvdpgkilighlgdtdntdyikkiadkgsfigldrygldlflpvdkrnettl
klikdgysdrimishdycctidwgtarpelkpklaprwsmalifedtipflkkngvseev
idiifkenpkkffs

SCOPe Domain Coordinates for d4g2da_:

Click to download the PDB-style file with coordinates for d4g2da_.
(The format of our PDB-style files is described here.)

Timeline for d4g2da_: