Class g: Small proteins [56992] (91 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (3 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [187112] (13 PDB entries) |
Domain d4fb1c_: 4fb1 C: [192925] automated match to d2bbkl_ complexed with ca, hec, mes, na |
PDB Entry: 4fb1 (more details), 2.15 Å
SCOPe Domain Sequences for d4fb1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fb1c_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d4fb1c_: