SCOPe 2.07: Domain d4hrrc1: 4hrr C:4-149

Lineage for d4hrrc1 (4hrr C:4-149)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)

8. Domain d4hrrc1: 4hrr C:4-149 [192917]
   Other proteins in same PDB: d4hrra2, d4hrrc2, d4hrre2, d4hrrg2
   automated match to d1scta_
   complexed with cmo, hem

Details for d4hrrc1

PDB Entry: 4hrr, 1.25 Å

PDB Description: Scapharca tetrameric hemoglobin, CO-state

PDB Compounds: (C:) Globin-2 A chain

SCOPe Domain Sequences for d4hrrc1:

Sequence; same for both SEQRES and ATOM records:

>d4hrrc1 a.1.1.2 (C:4-149) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
avakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkgkan
sklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmketlk
armgnyysddvagawaalvgvvqaal

Timeline for d4hrrc1:

• d4hrrc1 first appeared in SCOPe 2.02, called d4hrrc_
  
• d4hrrc1 appears in SCOPe 2.06
  
• d4hrrc1 appears in the current release, SCOPe 2.08