Class a: All alpha proteins [46456] (179 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins) |
Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries) |
Domain d1exxa_: 1exx A: [19286] complexed with 395, lmu |
PDB Entry: 1exx (more details), 1.67 Å
SCOP Domain Sequences for d1exxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exxa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)} lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle
Timeline for d1exxa_: