Lineage for d1exxa_ (1exx A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285381Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 285382Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 285383Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins)
  6. 285530Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 285531Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 285537Domain d1exxa_: 1exx A: [19286]
    complexed with 395, lmu

Details for d1exxa_

PDB Entry: 1exx (more details), 1.67 Å

PDB Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the inactive s-enantiomer bms270395.

SCOP Domain Sequences for d1exxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exxa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOP Domain Coordinates for d1exxa_:

Click to download the PDB-style file with coordinates for d1exxa_.
(The format of our PDB-style files is described here.)

Timeline for d1exxa_: