Class a: All alpha proteins [46456] (285 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein Acyl carrier protein [47338] (6 species) |
Species Shigella flexneri [TaxId:373384] [192502] (1 PDB entry) |
Domain d4etwb_: 4etw B: [192817] Other proteins in same PDB: d4etwa_, d4etwc_ automated match to d1t8ka_ complexed with zmk |
PDB Entry: 4etw (more details), 2.05 Å
SCOPe Domain Sequences for d4etwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4etwb_ a.28.1.1 (B:) Acyl carrier protein {Shigella flexneri [TaxId: 373384]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyingh
Timeline for d4etwb_: