Lineage for d1fm6a_ (1fm6 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217562Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 217563Species Human (Homo sapiens) [TaxId:9606] [48511] (10 PDB entries)
  8. 217577Domain d1fm6a_: 1fm6 A: [19277]
    Other proteins in same PDB: d1fm6d_, d1fm6x_

Details for d1fm6a_

PDB Entry: 1fm6 (more details), 2.1 Å

PDB Description: the 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.

SCOP Domain Sequences for d1fm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm6a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens)}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d1fm6a_:

Click to download the PDB-style file with coordinates for d1fm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fm6a_: