Lineage for d2wnvd_ (2wnv D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306419Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1306420Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1306421Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1306467Protein Complement c1q globular head, A chain [101613] (1 species)
    hetrotrimer of A, B and C chains
  7. 1306468Species Human (Homo sapiens) [TaxId:9606] [101614] (5 PDB entries)
  8. 1306470Domain d2wnvd_: 2wnv D: [192752]
    Other proteins in same PDB: d2wnvb_, d2wnvc_, d2wnve_, d2wnvf_
    automated match to d1pk6a_
    complexed with 2dr, ca, nag

Details for d2wnvd_

PDB Entry: 2wnv (more details), 1.25 Å

PDB Description: complex between c1q globular heads and deoxyribose
PDB Compounds: (D:) complement c1q subcomponent subunit a

SCOPe Domain Sequences for d2wnvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnvd_ b.22.1.1 (D:) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifpsa

SCOPe Domain Coordinates for d2wnvd_:

Click to download the PDB-style file with coordinates for d2wnvd_.
(The format of our PDB-style files is described here.)

Timeline for d2wnvd_: