Lineage for d1fqvj1 (1fqv J:85-160)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735467Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2735474Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 2735475Species Human (Homo sapiens) [TaxId:9606] [81376] (9 PDB entries)
  8. 2735484Domain d1fqvj1: 1fqv J:85-160 [19266]
    Other proteins in same PDB: d1fqva1, d1fqva2, d1fqvb2, d1fqvc1, d1fqvc2, d1fqvd2, d1fqve1, d1fqve2, d1fqvf2, d1fqvg1, d1fqvg2, d1fqvh2, d1fqvi1, d1fqvi2, d1fqvj2, d1fqvk1, d1fqvk2, d1fqvl2, d1fqvm1, d1fqvm2, d1fqvn2, d1fqvo1, d1fqvo2, d1fqvp2

Details for d1fqvj1

PDB Entry: 1fqv (more details), 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (J:) skp1

SCOPe Domain Sequences for d1fqvj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqvj1 a.157.1.1 (J:85-160) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwc

SCOPe Domain Coordinates for d1fqvj1:

Click to download the PDB-style file with coordinates for d1fqvj1.
(The format of our PDB-style files is described here.)

Timeline for d1fqvj1: