![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
![]() | Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
![]() | Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
![]() | Domain d4il6l_: 4il6 L: [192656] Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_ automated match to d2axtl1 complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl |
PDB Entry: 4il6 (more details), 2.1 Å
SCOPe Domain Sequences for d4il6l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il6l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d4il6l_: