Lineage for d4elgf1 (4elg F:1-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511492Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2511508Domain d4elgf1: 4elg F:1-162 [192628]
    Other proteins in same PDB: d4elga2, d4elgb2, d4elgc2, d4elgd2, d4elge2, d4elgf2, d4elgg2, d4elgh2
    automated match to d3fl8a_
    complexed with 52i, 52j, ca, cl

Details for d4elgf1

PDB Entry: 4elg (more details), 2.1 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase
PDB Compounds: (F:) dihydrofolate reductase

SCOPe Domain Sequences for d4elgf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elgf1 c.71.1.0 (F:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d4elgf1:

Click to download the PDB-style file with coordinates for d4elgf1.
(The format of our PDB-style files is described here.)

Timeline for d4elgf1: