Lineage for d3v84a_ (3v84 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387550Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2387551Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2387552Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2387560Protein Thaumatin [49876] (1 species)
  7. 2387561Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (113 PDB entries)
    Uniprot P02883
  8. 2387642Domain d3v84a_: 3v84 A: [192535]
    automated match to d1thva_
    complexed with gol

Details for d3v84a_

PDB Entry: 3v84 (more details), 2.3 Å

PDB Description: Thaumatin by LB based Hanging Drop Vapour Diffusion after 1.81 MGy X-Ray dose at ESRF ID29 beamline (Worst Case)
PDB Compounds: (A:) thaumatin I

SCOPe Domain Sequences for d3v84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v84a_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d3v84a_:

Click to download the PDB-style file with coordinates for d3v84a_.
(The format of our PDB-style files is described here.)

Timeline for d3v84a_: