Lineage for d3sdky_ (3sdk Y:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2598776Domain d3sdky_: 3sdk Y: [192073]
    Other proteins in same PDB: d3sdkb_, d3sdkd_, d3sdkf_, d3sdkp_, d3sdkr_, d3sdkt_
    automated match to d1g0uk_
    complexed with mes, mg, p3n

Details for d3sdky_

PDB Entry: 3sdk (more details), 2.7 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 34
PDB Compounds: (Y:) Proteasome component PRE2

SCOPe Domain Sequences for d3sdky_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdky_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d3sdky_:

Click to download the PDB-style file with coordinates for d3sdky_.
(The format of our PDB-style files is described here.)

Timeline for d3sdky_: