Lineage for d1d8da_ (1d8d A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775631Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 775632Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 775633Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 775680Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
    Uniprot Q04631 55-369
  8. 775681Domain d1d8da_: 1d8d A: [19185]
    Other proteins in same PDB: d1d8db_
    complex with K-ras4b peptide substrate

Details for d1d8da_

PDB Entry: 1d8d (more details), 2 Å

PDB Description: co-crystal structure of rat protein farnesyltransferase complexed with a k-ras4b peptide substrate and fpp analog at 2.0a resolution
PDB Compounds: (A:) farnesyltransferase (alpha subunit)

SCOP Domain Sequences for d1d8da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8da_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsresdipasv

SCOP Domain Coordinates for d1d8da_:

Click to download the PDB-style file with coordinates for d1d8da_.
(The format of our PDB-style files is described here.)

Timeline for d1d8da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d8db_