Lineage for d3bz2z_ (3bz2 Z:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697026Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. Superfamily f.17.5: PsbZ-like [161055] (1 family) (S)
    automatically mapped to Pfam PF01737
  5. Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. Species Thermosynechococcus elongatus [TaxId:146786] [161058] (4 PDB entries)
    Uniprot Q8DHJ2 1-62
  8. 1697217Domain d3bz2z_: 3bz2 Z: [191703]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_
    automated match to d2axtz1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2z_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d3bz2z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d3bz2z_:

Click to download the PDB-style file with coordinates for d3bz2z_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2z_: