Lineage for d1g3nb_ (1g3n B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616021Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 616022Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 616023Family d.211.1.1: Ankyrin repeat [48404] (16 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 616076Protein p18ink4C(ink6) [48412] (1 species)
  7. 616077Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)
  8. 616086Domain d1g3nb_: 1g3n B: [19163]
    Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2

Details for d1g3nb_

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3nb_ d.211.1.1 (B:) p18ink4C(ink6) {Human (Homo sapiens)}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang

SCOP Domain Coordinates for d1g3nb_:

Click to download the PDB-style file with coordinates for d1g3nb_.
(The format of our PDB-style files is described here.)

Timeline for d1g3nb_: