Lineage for d1g3nb_ (1g3n B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006577Protein p18ink4C(ink6) [48412] (1 species)
  7. 3006578Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)
  8. 3006587Domain d1g3nb_: 1g3n B: [19163]
    Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2

Details for d1g3nb_

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
PDB Compounds: (B:) cyclin-dependent kinase 6 inhibitor

SCOPe Domain Sequences for d1g3nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3nb_ d.211.1.1 (B:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang

SCOPe Domain Coordinates for d1g3nb_:

Click to download the PDB-style file with coordinates for d1g3nb_.
(The format of our PDB-style files is described here.)

Timeline for d1g3nb_: