Lineage for d1bpob1 (1bpo B:331-493)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338696Family a.118.1.4: Clathrin heavy-chain linker domain [48393] (1 protein)
    this is a repeat family; one repeat unit is 1bpo B:444-471 found in domain
  6. 2338697Protein Clathrin heavy-chain linker domain [48394] (1 species)
  7. 2338698Species Norway rat (Rattus norvegicus) [TaxId:10116] [48395] (5 PDB entries)
  8. 2338703Domain d1bpob1: 1bpo B:331-493 [19144]
    Other proteins in same PDB: d1bpoa2, d1bpob2, d1bpoc2

Details for d1bpob1

PDB Entry: 1bpo (more details), 2.6 Å

PDB Description: clathrin heavy-chain terminal domain and linker
PDB Compounds: (B:) protein (clathrin)

SCOPe Domain Sequences for d1bpob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpob1 a.118.1.4 (B:331-493) Clathrin heavy-chain linker domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eeniipyitnvlqnpdlalrmavrnnlagaeelfarkfnalfaqgnyseaakvaanapkg
ilrtpdtirrfqsvpaqpgqtspllqyfgilldqgqlnkyeslelcrpvlqqgrkqllek
wlkedklecseelgdlvksvdptlalsvylranvpnkviqcfa

SCOPe Domain Coordinates for d1bpob1:

Click to download the PDB-style file with coordinates for d1bpob1.
(The format of our PDB-style files is described here.)

Timeline for d1bpob1: