Lineage for d1dd3b1 (1dd3 B:1-57)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338089Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 2338090Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 2338091Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 2338092Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 2338104Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries)
  8. 2338124Domain d1dd3b1: 1dd3 B:1-57 [19032]
    Other proteins in same PDB: d1dd3a2, d1dd3b2

Details for d1dd3b1

PDB Entry: 1dd3 (more details), 2 Å

PDB Description: crystal structure of ribosomal protein l12 from thermotoga maritima
PDB Compounds: (B:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd3b1 a.108.1.1 (B:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOPe Domain Coordinates for d1dd3b1:

Click to download the PDB-style file with coordinates for d1dd3b1.
(The format of our PDB-style files is described here.)

Timeline for d1dd3b1: