Lineage for d4fisb_ (4fis B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305998Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 2306003Protein FIS protein [48285] (2 species)
    includes N-terminal dimerisation subdomain
  7. 2306031Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)
  8. 2306049Domain d4fisb_: 4fis B: [18997]
    mutant

Details for d4fisb_

PDB Entry: 4fis (more details), 2.3 Å

PDB Description: the molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding
PDB Compounds: (B:) factor for inversion stimulation (fis)

SCOPe Domain Sequences for d4fisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fisb_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalmmginr
gtlckklkkygmn

SCOPe Domain Coordinates for d4fisb_:

Click to download the PDB-style file with coordinates for d4fisb_.
(The format of our PDB-style files is described here.)

Timeline for d4fisb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fisa_