Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.12: FIS-like [100918] (4 proteins) |
Protein FIS protein [48285] (2 species) includes N-terminal dimerisation subdomain |
Species Escherichia coli [TaxId:562] [48286] (16 PDB entries) |
Domain d4fisb_: 4fis B: [18997] mutant |
PDB Entry: 4fis (more details), 2.3 Å
SCOPe Domain Sequences for d4fisb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fisb_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]} plrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalmmginr gtlckklkkygmn
Timeline for d4fisb_: