Lineage for d1f14b1 (1f14 B:204-302)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155193Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 155194Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (8 families) (S)
  5. 155217Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)
  6. 155218Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
  7. 155219Species Human (Homo sapiens) [TaxId:9606] [48189] (7 PDB entries)
  8. 155231Domain d1f14b1: 1f14 B:204-302 [18802]
    Other proteins in same PDB: d1f14a2, d1f14b2

Details for d1f14b1

PDB Entry: 1f14 (more details), 2.3 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase (apo)

SCOP Domain Sequences for d1f14b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f14b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOP Domain Coordinates for d1f14b1:

Click to download the PDB-style file with coordinates for d1f14b1.
(The format of our PDB-style files is described here.)

Timeline for d1f14b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f14b2