![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins) |
![]() | Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species) Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries) |
![]() | Domain d1f14a1: 1f14 A:204-302 [18801] Other proteins in same PDB: d1f14a2, d1f14b2 |
PDB Entry: 1f14 (more details), 2.3 Å
SCOP Domain Sequences for d1f14a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f14a1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd gwhemdaenplhqpspslnklvaenkfgkktgegfykyk
Timeline for d1f14a1: