Class a: All alpha proteins [46456] (171 folds) |
Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (2 families) |
Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein) |
Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species) |
Species Thermus thermophilus [TaxId:274] [48166] (6 PDB entries) |
Domain d1gln_1: 1gln 306-468 [18752] Other proteins in same PDB: d1gln_2 |
PDB Entry: 1gln (more details), 2.5 Å
SCOP Domain Sequences for d1gln_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gln_1 a.97.1.1 (306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus} dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv klgqvaqplraaltgsletpglfeilallgkeralrrlerala
Timeline for d1gln_1: