SCOP 1.63: Domain d1gln_1: 1gln 306-468

Lineage for d1gln_1 (1gln 306-468)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (2 families)

5. Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)

6. Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)

7. Species Thermus thermophilus [TaxId:274] [48166] (6 PDB entries)

8. Domain d1gln_1: 1gln 306-468 [18752]
   Other proteins in same PDB: d1gln_2

Details for d1gln_1

PDB Entry: 1gln, 2.5 Å

PDB Description: architectures of class-defining and specific domains of glutamyl-trna synthetase

SCOP Domain Sequences for d1gln_1:

Sequence; same for both SEQRES and ATOM records:

>d1gln_1 a.97.1.1 (306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

Timeline for d1gln_1:

• d1gln_1 first appeared (with stable ids) in SCOP 1.55
  
• d1gln_1 appears in SCOP 1.61
  
• d1gln_1 appears in SCOP 1.65
  
• d1gln_1 appears in the current release, SCOPe 2.08, called d1glna1