| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() automatically mapped to Pfam PF01280 |
| Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
| Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
| Domain d1ffkm_: 1ffk M: [18740] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ complexed with cd, k, mg |
PDB Entry: 1ffk (more details), 2.4 Å
SCOPe Domain Sequences for d1ffkm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkm_ a.94.1.1 (M:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida
Timeline for d1ffkm_:
View in 3DDomains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_ |