Lineage for d3zu8a1 (3zu8 A:5-153)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377026Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2377160Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2377161Protein automated matches [191113] (12 species)
    not a true protein
  7. 2377162Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)
  8. 2377165Domain d3zu8a1: 3zu8 A:5-153 [186573]
    Other proteins in same PDB: d3zu8a2
    automated match to d1nbca_
    complexed with 1pe, ca, edo, ni

Details for d3zu8a1

PDB Entry: 3zu8 (more details), 1.8 Å

PDB Description: structure of cbm3b of major scaffoldin subunit scaa from acetivibrio cellulolyticus determined on the nikel absorption edge
PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d3zu8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zu8a1 b.2.2.0 (A:5-153) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
nlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcdwspv
gssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynqaddy
sfnssattytswdkvtaysaegliwgiep

SCOPe Domain Coordinates for d3zu8a1:

Click to download the PDB-style file with coordinates for d3zu8a1.
(The format of our PDB-style files is described here.)

Timeline for d3zu8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zu8a2