Lineage for d3v2ta_ (3v2t A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313474Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1313475Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1313476Protein Staphylococcal nuclease [50201] (1 species)
  7. 1313477Species Staphylococcus aureus [TaxId:1280] [50202] (186 PDB entries)
    Uniprot P00644 89-223
  8. 1313520Domain d3v2ta_: 3v2t A: [186457]
    automated match to d1joka_
    complexed with ca, thp

Details for d3v2ta_

PDB Entry: 3v2t (more details), 1.8 Å

PDB Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I92A/V66A at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3v2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v2ta_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmaenakki
evefdkgqrtdkygrglayayadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d3v2ta_:

Click to download the PDB-style file with coordinates for d3v2ta_.
(The format of our PDB-style files is described here.)

Timeline for d3v2ta_: