Lineage for d3unza_ (3unz A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586292Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 2586293Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries)
  8. 2586337Domain d3unza_: 3unz A: [186353]
    automated match to d1ol5a_
    complexed with 0bz, edo

Details for d3unza_

PDB Entry: 3unz (more details), 2.8 Å

PDB Description: Aurora A in Complex with RPM1679
PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d3unza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unza_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
chskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemiegrmh
dekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkh
npsqrpmlrevlehpwitanssk

SCOPe Domain Coordinates for d3unza_:

Click to download the PDB-style file with coordinates for d3unza_.
(The format of our PDB-style files is described here.)

Timeline for d3unza_: