Lineage for d3uiec_ (3uie C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598536Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries)
  8. 1598539Domain d3uiec_: 3uie C: [186320]
    automated match to d1m7gc_
    complexed with adx, anp, mg

Details for d3uiec_

PDB Entry: 3uie (more details), 1.79 Å

PDB Description: crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps
PDB Compounds: (C:) Adenylyl-sulfate kinase 1, chloroplastic

SCOPe Domain Sequences for d3uiec_:

Sequence, based on SEQRES records: (download)

>d3uiec_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
dvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekvv
gyldnkgylqa

Sequence, based on observed residues (ATOM records): (download)

>d3uiec_ c.37.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
csvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgln
rdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevfm
dvplsvceardpkglyklaragkikgftgiddpyepplnceislgtspiemaekvvgyld
nkgylqa

SCOPe Domain Coordinates for d3uiec_:

Click to download the PDB-style file with coordinates for d3uiec_.
(The format of our PDB-style files is described here.)

Timeline for d3uiec_: