SCOPe 2.07: Domain d3t3ab_: 3t3a B:

Lineage for d3t3ab_ (3t3a B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (29 PDB entries)

8. Domain d3t3ab_: 3t3a B: [185633]
   automated match to d1ypoa1
   complexed with po4; mutant

Details for d3t3ab_

PDB Entry: 3t3a, 2.3 Å

PDB Description: Crystal structure of H107R mutant of extracellular domain of mouse receptor NKR-P1A

PDB Compounds: (B:) Killer cell lectin-like receptor subfamily B member 1A

SCOPe Domain Sequences for d3t3ab_:

Sequence, based on SEQRES records:

>d3t3ab_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekynsf
wiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicqk
el

Sequence, based on observed residues (ATOM records):

>d3t3ab_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ecpqdwlshrdkcfrvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikeknsfw
iglrytlmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicqkel

Timeline for d3t3ab_:

• d3t3ab_ first appeared in SCOPe 2.01
  
• d3t3ab_ appears in SCOPe 2.06
  
• d3t3ab_ appears in the current release, SCOPe 2.08