Lineage for d3st9e_ (3st9 E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1353897Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 1353898Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 1354012Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries)
  8. 1354031Domain d3st9e_: 3st9 E: [185528]
    automated match to d1tyfa_
    complexed with ca, gol, so4

Details for d3st9e_

PDB Entry: 3st9 (more details), 2.43 Å

PDB Description: Crystal structure of ClpP in heptameric form from Staphylococcus aureus
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3st9e_:

Sequence, based on SEQRES records: (download)

>d3st9e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqateiei
aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

Sequence, based on observed residues (ATOM records): (download)

>d3st9e_ c.14.1.1 (E:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplaqgqateieiaa
nhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

SCOPe Domain Coordinates for d3st9e_:

Click to download the PDB-style file with coordinates for d3st9e_.
(The format of our PDB-style files is described here.)

Timeline for d3st9e_: