Lineage for d3shjz_ (3shj Z:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2597803Domain d3shjz_: 3shj Z: [185403]
    Other proteins in same PDB: d3shja_, d3shjb_, d3shjc_, d3shje_, d3shjf_, d3shjg_, d3shjo_, d3shjp_, d3shjq_, d3shjs_, d3shjt_, d3shju_
    automated match to d1g0ul_
    complexed with h10, mes

Details for d3shjz_

PDB Entry: 3shj (more details), 2.8 Å

PDB Description: Proteasome in complex with hydroxyurea derivative HU10
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d3shjz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shjz_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3shjz_:

Click to download the PDB-style file with coordinates for d3shjz_.
(The format of our PDB-style files is described here.)

Timeline for d3shjz_: