SCOPe 2.07: Domain d3sbla1: 3sbl A:39-269

Lineage for d3sbla1 (3sbl A:39-269)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d3sbla1: 3sbl A:39-269 [185350]
   Other proteins in same PDB: d3sbla2
   automated match to d1ko2a_
   complexed with cit

Details for d3sbla1

PDB Entry: 3sbl, 2.31 Å

PDB Description: Crystal Structure of New Delhi Metal-beta-lactamase-1 from Klebsiella pneumoniae

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3sbla1:

Sequence; same for both SEQRES and ATOM records:

>d3sbla1 d.157.1.0 (A:39-269) automated matches {Klebsiella pneumoniae [TaxId: 573]}
metgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqt
aqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaq
hsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaksl
gnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

Timeline for d3sbla1:

• d3sbla1 first appeared in SCOPe 2.01, called d3sbla_
  
• d3sbla1 appears in SCOPe 2.06
  
• d3sbla1 appears in the current release, SCOPe 2.08