Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein automated matches [190236] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188722] (34 PDB entries) |
Domain d3r85a_: 3r85 A: [184840] automated match to d1g5ja_ complexed with so4 |
PDB Entry: 3r85 (more details), 1.95 Å
SCOPe Domain Sequences for d3r85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r85a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} snrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpgta yqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhle pwiqenggwdtfvelygn
Timeline for d3r85a_: