Lineage for d3qy3a1 (3qy3 A:5-134)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1409953Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1409988Protein Hypothetical protein PA2801 [143162] (1 species)
  7. 1409989Species Pseudomonas aeruginosa [TaxId:287] [143163] (1 PDB entry)
    Uniprot Q9I042 5-134
  8. 1409990Domain d3qy3a1: 3qy3 A:5-134 [184690]
    complexed with cl

Details for d3qy3a1

PDB Entry: 3qy3 (more details), 1.75 Å

PDB Description: PA2801 protein, a putative Thioesterase from Pseudomonas aeruginosa
PDB Compounds: (A:) thioesterase

SCOPe Domain Sequences for d3qy3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qy3a1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]}
qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht
ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp
vpdsiraaia

SCOPe Domain Coordinates for d3qy3a1:

Click to download the PDB-style file with coordinates for d3qy3a1.
(The format of our PDB-style files is described here.)

Timeline for d3qy3a1: