SCOPe 2.04: Domain d3qvyd_: 3qvy D:

Lineage for d3qvyd_ (3qvy D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (2 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (31 PDB entries)

8. Domain d3qvyd_: 3qvy D: [184650]
   automated match to d1qq3a_
   complexed with hem, me7, zn

Details for d3qvyd_

PDB Entry: 3qvy, 2.3 Å

PDB Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMOE crosslinks

PDB Compounds: (D:) Cytochrome cb562

SCOPe Domain Sequences for d3qvyd_:

Sequence; same for both SEQRES and ATOM records:

>d3qvyd_ a.24.3.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

Timeline for d3qvyd_:

• d3qvyd_ first appeared in SCOPe 2.01
  
• d3qvyd_ appears in SCOPe 2.03
  
• d3qvyd_ appears in SCOPe 2.05
  
• d3qvyd_ appears in the current release, SCOPe 2.08