SCOPe 2.07: Domain d3qvya_: 3qvy A:

Lineage for d3qvya_ (3qvy A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d3qvya_: 3qvy A: [184647]
   automated match to d1qq3a_
   complexed with hem, me7, zn

Details for d3qvya_

PDB Entry: 3qvy, 2.3 Å

PDB Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMOE crosslinks

PDB Compounds: (A:) Cytochrome cb562

SCOPe Domain Sequences for d3qvya_:

Sequence; same for both SEQRES and ATOM records:

>d3qvya_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

Timeline for d3qvya_:

• d3qvya_ first appeared in SCOPe 2.01
  
• d3qvya_ appears in SCOPe 2.06
  
• d3qvya_ appears in the current release, SCOPe 2.08